Information about Zif268

Cartoon representation of Zif268 (blue) containing three zinc fingers in complex with DNA (orange). The coordinating amino acid residues of the middle zinc ion (green) are highlighted.
early growth response 1
Identifiers
SymbolEGR1
Entrez1958
HUGO3238
OMIM128990
RefSeqNM_001964
UniProtP18146
Other data
LocusChr. 5 q31.1
Zif268 is a mammalian transcription factor that is now officially known as Egr1 (Early Growth Response Protein 1). It was also named Krox-24, NGFI-A, TIS8, and ZENK. It was originally discovered in mouse.

Structure

The DNA binding domain of Zif268 consists of three zinc finger domains of the Cys2His2 type. The amino acid structure of the Zif268 zinc finger domain is given in this table, using the single letter amino acid code. The fingers 1 to 3 are indicated by f1 - f3. The numbers are in reference to the residues (amino acids) of alpha helix (there is no '0'). The residues marked 'x' are not part of the zinc fingers, but rather serve to connect them all together.

-1123456789xxxxx
f1MAEERPYACPVESCDRRFSRSDELTRHIRIHTGQKP
f2FOCAI??CMRNFSRSDHLTTHIATHTGEKP | f3 || || || || || || || F || A || C || D || I || ? || ? || C || G || R || K || F || A || R || S || D || E || R || K || R || H || T || K || I || H || L || R || Q || K || D |


The crystal structure of DNA bound by the zinc finger domain of Zif268 was solved in 1991, which greatly aided early research in zinc finger DNA-binding domains.[1]

The human Zif268/EGR1 protein contains (in its unprocessed form) 543 amino acids with a molecular weight of 57.5 kDa, and the gene is located on the chromosome 5.

Function

Zif268 binds the DNA sequence 5'-GC[G/T]GGGCG-3.[2][3]

It has a distinct pattern of expression in the brain, and its induction has been shown to be assiociated with neuronal activity. Several studies suggest it has a role in neuronal plasticity.[4]

Zif268 has also been found to regulate the expression of synaptobrevin II (a protein important for synaptic exocytosis).[5]

References

1. ^ Pavletich, N. P. and C. O. Pabo (1991). "Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A." Science 252(5007): 809-17.
2. ^ Christy, B. and D. Nathans (1989). "DNA binding site of the growth factor-inducible protein Zif268." Proc Natl Acad Sci U S An 86(22): 8737-41.
3. ^ Swirnoff, A. H. and J. Milbrandt (1995). "DNA-binding specificity of NGFI-A and related zinc finger transcription factors." Mol Cell Biol 15(4): 2275-87.
4. ^ Knapska, E and Kaczmarek, L (2004) "A gene for Neuronal Plasticity in the Mammalian Brain: Zif286/Egr1/NGFI-A/Krox-24/TIS-8/ZENK?" Progress in Neurobiology 74, 2004
5. ^ Petersohn,D and Thiel. G (1996)"Role of zinc-finger proteins Sp1 and zif268/egr-1 in transcriptional regulation of the human synaptobrevin II gene" European Journal of Biochemistry, 239, 1996

External links

The Entrez Global Query Cross-Database Search System is a powerful federated search engine, or web portal that allows users to search many discrete health sciences databases at the National Center for Biotechnology Information (NCBI) website.
..... Click the link for more information.
Hugo is a male given name, a latinized form of the name Hugh, a German/Teutonic name meaning "Bright in Mind and Spirit".

Hugo is one of the most popular names in Europe ranking as high as #2 in France, #6 in Spain, and #7 in Belgium in 2006.
..... Click the link for more information.
The National Center for Biotechnology Information (NCBI) is part of the United States National Library of Medicine (NLM), a branch of the National Institutes of Health. The NCBI is located in Bethesda, Maryland and was founded in 1988.
..... Click the link for more information.
Swiss-Prot is a manually curated biological database of protein sequences. Swiss-Prot was created in 1986 by Amos Bairoch during his PhD and developed by the Swiss Institute of Bioinformatics and the European Bioinformatics Institute.
..... Click the link for more information.
locus (plural loci) is a fixed position on a chromosome, such as the position of a gene or a biomarker (genetic marker). A variant of the DNA sequence at a given locus is called an allele. The ordered list of loci known for a particular genome is called a genetic map.
..... Click the link for more information.
This article or section may be confusing or unclear for some readers.
Please [improve the article] or discuss this issue on the talk page. This article has been tagged since December 2006.
..... Click the link for more information.
M. musculus

Binomial name
Mus musculus
Linnaeus, 1758

The common House Mouse (Mus musculus) is one of the most numerous species of the genus Mus
..... Click the link for more information.
zinc finger is a protein domain that can bind to DNA. A zinc finger consists of two antiparallel β sheets, and an α helix. The zinc ion is crucial for the stability of this domain type - in absence of the metal ion the domain unfolds as it is too small to have a
..... Click the link for more information.
alpha helix (α-helix) is a right-handed coiled conformation, resembling a spring, in which every backbone N-H group donates a hydrogen bond to the backbone C=O group of the amino acid four residues earlier ( hydrogen bonding). (See also helix.
..... Click the link for more information.
crystal structure is a unique arrangement of atoms in a crystal. A crystal structure is composed of a motif, a set of atoms arranged in a particular way, and a lattice. Motifs are located upon the points of a lattice, which is an array of points repeating periodically in three
..... Click the link for more information.
Editing of this page by unregistered or newly registered users is currently disabled due to vandalism.
If you are prevented from editing this page, and you wish to make a change, please discuss changes on the talk page, request unprotection, log in, or .
..... Click the link for more information.
19th century - 20th century - 21st century
1960s  1970s  1980s  - 1990s -  2000s  2010s  2020s
1988 1989 1990 - 1991 - 1992 1993 1994

Year 1991 (MCMXCI
..... Click the link for more information.
Possible meanings:
  1. Kachin Defense Army
  2. Kentucky Distillers Association
  3. Kongsberg Defence & Aerospace
  4. kDa Atomic mass unit
  5. Kotelawala Defence Academy

..... Click the link for more information.
Chromosome 5 is one of the 23 pairs of chromosomes in humans. People normally have two copies of this chromosome. Chromosome 5 spans about 181 million base pairs (the building blocks of DNA) and represents almost 6% of the total DNA in cells.
..... Click the link for more information.
synaptic plasticity is the ability of the connection, or synapse, between two neurons to change in strength. There are several underlying mechanisms that cooperate to achieve synaptic plasticity, including changes in the quantity of neurotransmitter released into a synapse and
..... Click the link for more information.
Synaptobrevins (synaptobrevin isotypes 1-2) are small integral membrane proteins of secretory vesicles with molecular weight of 18 kilodalton (kDa) that are part of the vesicle-associated membrane protein (VAMP) family.
..... Click the link for more information.
synapse. Synapses allow nerve cells to communicate with one another through axons and dendrites, converting electrical impulses into chemical signals.]]

Chemical synapses
..... Click the link for more information.
Exocytosis (ek-soh-sy-TOH-sis) is the process by which a cell directs secretory vesicles to the cell membrane. These membrane-bound vesicles contain soluble proteins to be secreted to the extracellular environment, as well as membrane proteins and lipids that are sent to become
..... Click the link for more information.
Medical Subject Headings (MeSH) is a huge controlled vocabulary (or metadata system) for the purpose of indexing journal articles and books in the life sciences. Created and updated by the United States National Library of Medicine (NLM), it is used by the MEDLINE/PubMed
..... Click the link for more information.
This article or section may be confusing or unclear for some readers.
Please [improve the article] or discuss this issue on the talk page. This article has been tagged since December 2006.
..... Click the link for more information.
Intracellular receptors are receptors located inside the cell rather than on its cell membrane. Examples are the class of nuclear receptors located in the cell nucleus and the IP3 receptor located on the endoplasmic reticulum.
..... Click the link for more information.
General transcription factors (GTF's) are protein transcription factors which have been shown to be important in the transcription of class II genes to mRNA templates. Many of them are involved in the formation of a preinitiation complex, which, together with RNA polymerase II,
..... Click the link for more information.
Identifiers
Symbol GTF2A2

Entrez 2958
HUGO 4647
OMIM 600519

RefSeq NM_004492
UniProt P52657
Other data

Locus Chr. 15 q21.3

Transcription factor TFIIA
..... Click the link for more information.
basic-helix-loop-helix (bHLH) is a protein structural motif that characterizes a family of transcription factors.

Structure

The motif is characterized by two α helices connected by a loop.
..... Click the link for more information.
The Aryl hydrocarbon receptor (AhR) is member of the family of basic-helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones.
..... Click the link for more information.
Identifiers
Symbol ARNTL2

Entrez 56938
HUGO 18984

RefSeq NM_020183
UniProt Q8WYA4
Other data

Locus Chr. 12 p12.2-11.2 Bmal (brain and muscle aryl hydrocarbon receptor nuclear translocator (ARNT)-like
..... Click the link for more information.
Circadian Locomotor Output Cycles Kaput, or Clock is a gene which encodes proteins regulating circadian rhythm. The CLOCK protein seems to affect both the persistence and length of the circadian cycle. CLOCK forms part of a basic-helix-loop-helix transcription factor.
..... Click the link for more information.
E2F is a group of genes that codifies a family of transcription factors (TF) in higher eukaryotes. Three of them are activators: E2F1,2 and E2F3a. Six others act as suppressors: E2F3b, E2F4-8.
..... Click the link for more information.
Identifiers
Symbol HIF3A

Entrez 64344
HUGO 15825
OMIM 609976

RefSeq NM_152794
UniProt Q9Y2N7
Other data

Locus Chr. 19 q13 Hypoxia inducible factors (HIFs)
..... Click the link for more information.
Myc (cMyc) is a protooncogene, which is overexpressed in a wide range of human cancers. When it is specifically-mutated, or overexpressed, it increases cell proliferation and functions as an oncogene.
..... Click the link for more information.


This article is copied from an article on Wikipedia.org - the free encyclopedia created and edited by online user community. The text was not checked or edited by anyone on our staff. Although the vast majority of the wikipedia encyclopedia articles provide accurate and timely information please do not assume the accuracy of any particular article. This article is distributed under the terms of GNU Free Documentation License.
Herod_Archelaus


page counter